-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSEN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 267-384 of human PSEN2 (NP_000438.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PSEN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 267-384 of human PSEN2 (NP_000438.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00070A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSEN2 |
| Target Synonyms | AD4; PS2; AD3L; STM2; CMD1V; PSEN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 267-384 of human PSEN2 (NP_000438.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGD | Uniprot ID | P49810 |
Uniprot Id
P49810
Target Species
Human
Target Name
PSEN2
Target Full Name
Presenilin-2
Target Function
Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Requires the other members of the gamma-secretase complex to have a protease activity. May play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. May function in the cytoplasmic partitioning of proteins. The holoprotein functions as a calcium-leak channel that allows the passive movement of calcium from endoplasmic reticulum to cytosol and is involved in calcium homeostasis. Is a regulator of mitochondrion-endoplasmic reticulum membrane tethering and modulates calcium ions shuttling between ER and mitochondria.
Target Involvement
Alzheimer disease 4 (AD4); Cardiomyopathy, dilated 1V (CMD1V)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
Peptidase A22A family
Target Tissue Specificity
Isoform 1 is seen in the placenta, skeletal muscle and heart while isoform 2 is seen in the heart, brain, placenta, liver, skeletal muscle and kidney.
Target Synonyms
AD3L; AD3LP; AD4; AD5; Alzheimer disease 4; CMD1V; E5-1; OTTHUMP00000035671; OTTHUMP00000035672; OTTHUMP00000228286; OTTHUMP00000228288; Presenilin 2 (Alzheimer disease 4); Presenilin 2; Presenilin-2 CTF subunit; PS-2; PS2; Psen2; PSN2_HUMAN; PSNL2; STM-2; STM2
Target Background
Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes. Two alternatively spliced transcript variants encoding different isoforms of PSEN2 have been identified.
Notification