Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLRC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human KLRC4 (NP_038459.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against KLRC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human KLRC4 (NP_038459.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00622A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLRC4 |
| Target Synonyms | NKG2F; NKG2-F; KLRC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A-549, Mouse lung, NCI-H460, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human KLRC4 (NP_038459.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGN | Uniprot ID | O43908 |
Uniprot Id
O43908
Target Species
Human
Target Name
KLRC4
Target Full Name
NKG2-F type II integral membrane protein
Target Function
May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Tissue Specificity
Natural killer cells.
Target Synonyms
KLRC4; NKG2F; NKG2-F type II integral membrane protein; NK cell receptor F; NKG2-F-activating NK receptor
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
