Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IMP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human IMP3 (NP_060755.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IMP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human IMP3 (NP_060755.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01090A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IMP3 |
| Target Synonyms | BRMS2; MRPS4; C15orf12; IMP3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse spleen, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human IMP3 (NP_060755.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA | Uniprot ID | Q9NV31 |
Uniprot Id
Q9NV31
Target Species
Human
Target Name
IMP3
Target Full Name
U3 small nucleolar ribonucleoprotein protein IMP3
Target Function
Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Universal ribosomal protein uS4 family
Target Synonyms
BRMS2; C15orf12; Chromosome 15 open reading frame 12; DKFZp586L0118; FLJ10968; imp3; IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast); IMP3_HUMAN; Mitochondrial ribosomal protein S4; MRPS4; OTTHUMP00000183524; U3 small nucleolar ribonucleoprotein protein imp3; U3 snoRNP protein 3 homolog; U3 snoRNP protein imp3
Target Background
This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
