Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GDF10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 369-478 of human GDF10 (NP_004953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GDF10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 369-478 of human GDF10 (NP_004953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01630A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GDF10 |
| Target Synonyms | BIP; BMP3B; BMP-3b; GDF10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, BxPC-3, Mouse brain, Mouse liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 369-478 of human GDF10 (NP_004953.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR | Uniprot ID | P55107 |
Uniprot Id
P55107
Target Species
Human
Target Name
GDF10
Target Full Name
Growth/differentiation factor 10
Target Function
Growth factor involved in osteogenesis and adipogenesis. Plays an inhibitory role in the process of osteoblast differentiation via SMAD2/3 pathway. Plays an inhibitory role in the process of adipogenesis.
Target Subcellular Location
Secreted.
Target Protein Families
TGF-beta family
Target Tissue Specificity
Expressed in femur, brain, lung, skeletal muscle, pancreas and testis.
Target Research Area
Cancer
Target Synonyms
BIP; BMP 3b; BMP-3b; BMP3B; BMP3B_HUMAN; Bone inducing protein; Bone morphogenetic protein 3b [Precursor]; Bone morphogenetic protein 3b; Bone-inducing protein; GDF 10; GDF-10; Gdf10; growth differentiation factor 10; Growth/differentiation factor 10
Target Background
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This promotes neural repair after stroke. Additionally, this protein may act as a tumor suppressor and reduced expression of this gene is associated with oral cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
