Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NRL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-100 of human NRL (NP_006168.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NRL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-100 of human NRL (NP_006168.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04151A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NRL |
| Target Synonyms | RP27; D14S46E; NRL-MAF; NRL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 40-100 of human NRL (NP_006168.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQ | Uniprot ID | P54845 |
Uniprot Id
P54845
Target Species
Human
Target Name
NRL
Target Full Name
Neural retina-specific leucine zipper protein
Target Function
Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.
Target Involvement
Retinitis pigmentosa 27 (RP27); Retinal degeneration autosomal recessive clumped pigment type (RDCP)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
BZIP family
Target Tissue Specificity
Expressed in the brain and the retina. Expressed strongly in rod and cone cells (at protein level).
Target Research Area
Others
Target Synonyms
D14S46E; Neural retina-specific leucine zipper protein; Neural retinal specific leucine zipper; NRL; NRL MAF; NRL_HUMAN; RP27
Target Background
This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
