-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OPCML was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 246-345 of human OPCML (NP_002536.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OPCML was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 246-345 of human OPCML (NP_002536.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04272A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OPCML |
| Target Synonyms | OPCM; OBCAM; IGLON1; OPCML | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, 293T, Mouse brain, Mouse pancreas, Rat kidney, Rat pancreas, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 246-345 of human OPCML (NP_002536.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF | Uniprot ID | Q14982 |
Uniprot Id
Q14982
Target Species
Human
Target Name
OPCML
Target Full Name
Opioid-binding protein/cell adhesion molecule
Target Function
Binds opioids in the presence of acidic lipids; probably involved in cell contact.
Target Involvement
Ovarian cancer (OC)
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Protein Families
Immunoglobulin superfamily, IgLON family
Target Synonyms
GM181; IgLON family member 1; IGLON1; OBCAM; OPCM; OPCM_HUMAN; OPCML; Opiate binding cell adhesion molecule; Opioid binding cell adhesion molecule; Opioid binding protein/cell adhesion molecule; Opioid binding protein/cell adhesion molecule-like; Opioid binding protein/cell adhesion molecule-like preprotein; Opioid-binding cell adhesion molecule; Opioid-binding protein/cell adhesion molecule
Target Background
This gene encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily of proteins. The encoded preprotein is proteolytically processed to generate the mature protein. This protein is localized in the plasma membrane and may have an accessory role in opioid receptor function. This gene has an ortholog in rat and bovine. The opioid binding-cell adhesion molecule encoded by the rat gene binds opioid alkaloids in the presence of acidic lipids, exhibits selectivity for mu ligands and acts as a GPI-anchored protein. Since the encoded protein is highly conserved in species during evolution, it may have a fundamental role in mammalian systems. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification