Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 143-242 of human TRH (NP_009048.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TRH was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 143-242 of human TRH (NP_009048.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05616A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRH |
| Target Synonyms | TRF; Pro-TRH; TRH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BxPC-3, DU145, Mouse brain, Rat testis, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 143-242 of human TRH (NP_009048.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE | Uniprot ID | P20396 |
Uniprot Id
P20396
Target Species
Human
Target Name
TRH
Target Full Name
Pro-thyrotropin-releasing hormone
Target Function
As a component of the hypothalamic-pituitary-thyroid axis, it controls the secretion of thyroid-stimulating hormone (TSH) and is involved in thyroid hormone synthesis regulation. It also operates as modulator of hair growth. It promotes hair-shaft elongation, prolongs the hair cycle growth phase (anagen) and antagonizes its termination (catagen) by TGFB2. It stimulates proliferation and inhibits apoptosis of hair matrix keratinocytes.
Target Subcellular Location
Secreted.
Target Protein Families
TRH family
Target Tissue Specificity
Hypothalamus. Expressed in the hair follicle epithelium (at protein level).
Target Synonyms
TRH; Pro-thyrotropin-releasing hormone; Pro-TRH; Prothyroliberin) [Cleaved into: Thyrotropin-releasing hormone; TRH; Protirelin; TSH-releasing factor; Thyroliberin; Thyrotropin-releasing factor; TRF)]
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
