Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRF2BP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 475-545 of human IRF2BP2 (Q7Z5L9) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IRF2BP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 475-545 of human IRF2BP2 (Q7Z5L9) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07187A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRF2BP2 |
| Target Synonyms | CVID14; IRF2BP2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 475-545 of human IRF2BP2 (Q7Z5L9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGQGAGNTGGLEPVHPASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQQGASG | Uniprot ID | Q7Z5L9 |
Uniprot Id
Q7Z5L9
Target Species
Human
Target Name
IRF2BP2
Target Full Name
Interferon regulatory factor 2-binding protein 2
Target Function
Acts as a transcriptional corepressor in a IRF2-dependent manner; this repression is not mediated by histone deacetylase activities. Represses the NFAT1-dependent transactivation of NFAT-responsive promoters. Acts as a coactivator of VEGFA expression in cardiac and skeletal muscles. Plays a role in immature B-cell differentiation.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
IRF2BP family
Target Synonyms
I2BP2_HUMAN; Interferon regulatory factor 2 binding protein 2; Interferon regulatory factor 2-binding protein 2; IRF-2-binding protein 2; IRF-2BP2; IRF2 binding protein 2; IRF2BP2
Target Background
This gene encodes an interferon regulatory factor-2 (IRF2) binding protein that interacts with the C-terminal transcriptional repression domain of IRF2. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
