-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPRS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EPRS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10122A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPRS |
| Target Synonyms | EARS; EPRS; PARS; QARS; QPRS; HLD15; PIG32; GLUPRORS | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human EPRS (NP_004437.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS | Uniprot ID | P07814 |
Uniprot Id
P07814
Target Species
Human
Target Name
EPRS1
Target Full Name
Bifunctional glutamate/proline--tRNA ligase
Target Function
Multifunctional protein which is primarily part of the aminoacyl-tRNA synthetase multienzyme complex, also know as multisynthetase complex, that catalyzes the attachment of the cognate amino acid to the corresponding tRNA in a two-step reaction: the amino acid is first activated by ATP to form a covalent intermediate with AMP and is then transferred to the acceptor end of the cognate tRNA. The phosphorylation of EPRS1, induced by interferon-gamma, dissociates the protein from the aminoacyl-tRNA synthetase multienzyme complex and recruits it to the GAIT complex that binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin), suppressing their translation. Interferon-gamma can therefore redirect, in specific cells, the EPRS1 function from protein synthesis to translation inhibition. Also functions as an effector of the mTORC1 signaling pathway by promoting, through SLC27A1, the uptake of long-chain fatty acid by adipocytes. Thereby, it also plays a role in fat metabolism and more indirectly influences lifespan.
Target Subcellular Location
Cytoplasm, cytosol. Membrane; Peripheral membrane protein.
Target Protein Families
Class-I aminoacyl-tRNA synthetase family, Glutamate--tRNA ligase type 2 subfamily; Class-II aminoacyl-tRNA synthetase family
Target Synonyms
Bifunctional aminoacyl tRNA synthetase; Bifunctional aminoacyl-tRNA synthetase; Bifunctional glutamate/proline tRNA ligase; Cell proliferation-inducing gene 32 protein; DKFZp313B047; EARS; Eprs; GLNS; Glu pro tRNA synthetase ; GLUPRORS; GluRS; Glutamate tRNA ligase; Glutamatyl prolyl tRNA synthetase; Glutaminyl tRNA synthetase; Glutamyl prolyl tRNA synthetase; Glutamyl tRNA synthetase; Glutamyl-tRNA synthetase; PARS; PIG 32; PIG32; Proliferation inducing gene 32 protein; Proliferation inducing protein 32; Proline tRNA ligase; Proline--tRNA ligase; Prolyl tRNA synthetase ; Prolyl-tRNA synthetase; QARS; QPRS; SYEP_HUMAN
Target Background
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
Notification