-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MT-ND1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 151-251 of human MT-ND1 (YP_003024026.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MT-ND1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 151-251 of human MT-ND1 (YP_003024026.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10477A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MT-ND1 |
| Target Synonyms | MTND1; ND1; MT-ND1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, HepG2, PC-3, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 151-251 of human MT-ND1 (YP_003024026.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALS | Uniprot ID | P03886 |
Uniprot Id
P03886
Target Species
Human
Target Name
MT-ND1
Target Full Name
NADH-ubiquinone oxidoreductase chain 1
Target Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I.
Target Involvement
Leber hereditary optic neuropathy (LHON); Mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS); Alzheimer disease mitochondrial (AD-MT); Diabetes mellitus, non-insulin-dependent (NIDDM); Mitochondrial complex I deficiency (MT-C1D)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Complex I subunit 1 family
Target Synonyms
Complex I; subunit ND1; Mitochondrially encoded NADH dehydrogenase 1; MT-ND1; MTND1 ; NAD1 ; NADH dehydrogenase subunit 1 (complex I) ; NADH dehydrogenase subunit 1; NADH-ubiquinone oxidoreductase chain 1; NADH-ubiquinone oxidoreductase; subunit ND1; NADH1 ; ND1 ; NU1M_HUMAN
Target Background
Enables NADH dehydrogenase (ubiquinone) activity. Involved in mitochondrial electron transport, NADH to ubiquinone and mitochondrial respiratory chain complex I assembly. Located in mitochondrial membrane. Part of mitochondrial respiratory chain complex I. Implicated in several diseases, including MELAS syndrome; neurodegenerative disease (multiple); optic nerve disease (multiple); toxic shock syndrome; and type 2 diabetes mellitus. Biomarker of Alzheimer's disease; Parkinson's disease; and multiple sclerosis.
Notification