-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RhoB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RhoB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11272A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHOB |
| Target Synonyms | ARH6; ARHB; RHOH6; MST081; MSTP081; RhoB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Daudi, HCT116, Mouse brain, Rat lung, SK-BR-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-190 of human RhoB (NP_004031.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCI | Uniprot ID | P62745 |
Uniprot Id
P62745
Target Species
Human
Target Name
RHOB
Target Full Name
Rho-related GTP-binding protein RhoB
Target Function
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
Target Subcellular Location
Late endosome membrane; Lipid-anchor. Cell membrane; Lipid-anchor. Nucleus. Cleavage furrow. Note=Late endosomal membrane (geranylgeranylated form). Plasma membrane (farnesylated form). Also detected at the nuclear margin and in the nucleus. Translocates to the equatorial region before furrow formation in a ECT2-dependent manner.
Target Protein Families
Small GTPase superfamily, Rho family
Target Synonyms
Aplysia RAS-related homolog 6; ARH6; ARHB; H6; MST081; MSTP081; oncogene RHO H6; ras homolog family member B; ras homolog gene family; member B; Rho cDNA clone 6; Rho related GTP binding protein RhoB Precursor; Rho-related GTP-binding protein RhoB; Rhob; RHOB_HUMAN; RHOH6
Target Background
Predicted to enable GTP binding activity; GTPase activity; and protein kinase binding activity. Involved in several processes, including cellular response to hydrogen peroxide; cellular response to ionizing radiation; and regulation of cell migration. Located in cleavage furrow and endosome membrane. Biomarker of breast cancer.
Notification