-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BMPR1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-200 of human BMPR1A (NP_004320.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against BMPR1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-200 of human BMPR1A (NP_004320.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11331A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BMPR1A |
| Target Synonyms | ALK3; SKR5; ALK-3; CD292; ACVRLK3; BMPR-1A; 10q23del; BMPR1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-549, MCF7, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-200 of human BMPR1A (NP_004320.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFI | Uniprot ID | P36894 |
Uniprot Id
P36894
Target Species
Human
Target Name
BMPR1A
Target Full Name
Bone morphogenetic protein receptor type-1A
Target Function
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2, BMP4, GDF5 and GDF6. Positively regulates chondrocyte differentiation through GDF5 interaction. Mediates induction of adipogenesis by GDF6.
Target Involvement
Juvenile polyposis syndrome (JPS); Polyposis syndrome, mixed hereditary 2 (HMPS2)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell surface.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Target Tissue Specificity
Highly expressed in skeletal muscle.
Target Research Area
Cardiovascular
Target Synonyms
10q23del; Activin A receptor type II like kinase 3; Activin receptor like kinase 3; Activin receptor-like kinase 3; ACVRLK 3; ACVRLK3; ALK 3; ALK-3; ALK3; BMP type-1A receptor; BMPR 1A; Bmpr; BMPR-1A; Bmpr1a; BMR1A_HUMAN; Bone morphogenetic protein receptor type IA; Bone morphogenetic protein receptor type IA precursor; Bone morphogenetic protein receptor type-1A; BR 1a; BR1a; CD 292; CD292; CD292 antigen; EC 2.7.11.30; Serine threonine protein kinase receptor R5; Serine threonine protein kinase receptor R5 precursor; Serine/threonine-protein kinase receptor R5; SKR 5; SKR5; zBMPR IA; zBMPRIA
Target Background
The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding.
Notification