Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DET1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of arabidopsis thaliana DET1 (NP_192756.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DET1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of arabidopsis thaliana DET1 (NP_192756.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07194A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DET1 |
| Target Synonyms | ATDET1; DE-ETIOLATED 1; FUS2; FUSCA 2; T9A4.17; DET1 | Form | Liquid |
| Species Reactivity | Arabidopsis thaliana | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Before inflorescence, Inflorescences, Rosette leaf, Seedling | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of arabidopsis thaliana DET1 (NP_192756.2). | Immunogen Sequence | GGVTRSADHHPAFFAVYNMETTDIVAFYQNSAEDLYQLFEQFSDHFTVSSSTPFMNFVTSHSNNVYALEQLKYTKNKSNSFSQFVKKMLLSLPFSCQSQSP |
|---|---|---|---|
| Uniprot ID | P48732 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
