-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AARS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AARS (NP_001596.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against AARS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AARS (NP_001596.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05311A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AARS |
| Target Synonyms | AARS; TTD8; CMT2N; DEE29; HDLS2; EIEE29 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse brain, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AARS (NP_001596.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEM | Uniprot ID | P49588 |
Uniprot Id
P49588
Target Species
Human
Target Name
AARS1
Target Full Name
Alanine--tRNA ligase, cytoplasmic
Target Function
Catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). Also edits incorrectly charged tRNA(Ala) via its editing domain.
Target Involvement
Charcot-Marie-Tooth disease 2N (CMT2N); Epileptic encephalopathy, early infantile, 29 (EIEE29)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class-II aminoacyl-tRNA synthetase family
Target Synonyms
AARS; AI316495; Alanine tRNA ligase 1, cytoplasmic; Alanine tRNA ligase; Alanine tRNA ligase cytoplasmic; Alanine--tRNA ligase; Alanyl tRNA synthetase; Alanyl tRNA synthetase cytoplasmic; Alanyl-tRNA synthetase; AlaRS; C76919; CMT2N; cytoplasmic; EC 6.1.1.7; MGC37368; Renal carcinoma antigen NY REN 42; Renal carcinoma antigen NY-REN-42; SYAC_HUMAN
Target Background
The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.
Notification