-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ANAPC11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human ANAPC11 (NP_001002245.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ANAPC11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human ANAPC11 (NP_001002245.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05048A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ANAPC11 |
| Target Synonyms | APC11; Apc11p; HSPC214; ANAPC11 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-84 of human ANAPC11 (NP_001002245.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE | Uniprot ID | Q9NYG5 |
Uniprot Id
Q9NYG5
Target Species
Human
Target Name
ANAPC11
Target Full Name
Anaphase-promoting complex subunit 11
Target Function
Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
RING-box family
Target Tissue Specificity
Expressed at high levels in skeletal muscle and heart; in moderate levels in brain, kidney, and liver; and at low levels in colon, thymus, spleen, small intestine, placenta, lung and peripheral blood leukocyte.
Target Synonyms
ANAPC 11; ANAPC11; Anaphase promoting complex subunit 11 (yeast APC11 homolog); Anaphase promoting complex subunit 11; Anaphase promoting complex subunit 11 homolog (yeast); Anaphase promoting complex subunit 11 homolog; Anaphase-promoting complex subunit 11; Apc 11; Apc 11p; APC11 anaphase promoting complex subunit 11 homolog (yeast); APC11 anaphase promoting complex subunit 11 homolog; APC11; APC11_HUMAN; Apc11p; Cyclosome subunit 11; Hepatocellular carcinoma associated RING finger protein; Hepatocellular carcinoma-associated RING finger protein; HSPC 214; HSPC214; MGC882; Yeast APC 11 homolog; Yeast APC11 homolog
Target Background
Enables cullin family protein binding activity and ubiquitin-ubiquitin ligase activity. Contributes to ubiquitin-protein transferase activity. Involved in protein K11-linked ubiquitination. Located in nucleolus and nucleoplasm. Part of anaphase-promoting complex.
Notification