Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARVCF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARVCF (NP_001661.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ARVCF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARVCF (NP_001661.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08000A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARVCF |
| Target Synonyms | ARVCF | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARVCF (NP_001661.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTVEEDP | Uniprot ID | O00192 |
Uniprot Id
O00192
Target Species
Human
Target Name
ARVCF
Target Full Name
Splicing regulator ARVCF
Target Function
Involved in protein-protein interactions at adherens junctions.
Target Protein Families
Beta-catenin family
Target Tissue Specificity
Found in all the examined tissues including heart, brain, liver and kidney. Found at low level in lung.
Target Synonyms
Armadillo repeat gene deletes in velocardiofacial syndrome; Armadillo repeat protein; Armadillo repeat protein deleted in velo cardio facial syndrome; Armadillo repeat protein deleted in velo-cardio-facial syndrome; ARVC_HUMAN; Arvcf; FLJ35345; OTTHUMP00000028704; OTTHUMP00000198346; OTTHUMP00000198347; OTTHUMP00000198348
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
