Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATCAY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human ATCAY (NP_149053.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATCAY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human ATCAY (NP_149053.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05357A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ATCAY |
| Target Synonyms | CLAC; BNIP-H; ATCAY | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human ATCAY (NP_149053.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETD | Uniprot ID | Q86WG3 |
Uniprot Id
Q86WG3
Target Species
Human
Target Name
ATCAY
Target Full Name
Caytaxin
Target Function
Functions in the development of neural tissues, particularly the postnatal maturation of the cerebellar cortex. May play a role in neurotransmission through regulation of glutaminase/GLS, an enzyme responsible for the production in neurons of the glutamate neurotransmitter. Alternatively, may regulate the localization of mitochondria within axons and dendrites.
Target Involvement
Cerebellar ataxia, cayman type (ATCAY)
Target Subcellular Location
Cell projection, axon. Cell projection, dendrite. Cell junction, synapse, presynapse. Mitochondrion. Cell projection, growth cone. Cytoplasm.
Target Synonyms
Ataxia Cayman type protein; Ataxia; cerebellar; Cayman type; Atcay; ATCAY_HUMAN; BNIP 2 homolgy; BNIP 2 homology; BNIP H; BNIP-H; Cayman ataxia; Caytaxin; CLAC
Target Background
This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
