Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Calpain 2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human Calpain 2 (NP_001739.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Calpain 2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human Calpain 2 (NP_001739.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04307A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Calpain 2 |
| Target Synonyms | CANP2; mCANP; CANPL2; CANPml; Calpain 2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, Mouse skin | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 520-700 of human Calpain 2 (NP_001739.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LEEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL | Uniprot ID | P17655 |
Uniprot Id
P17655
Target Species
Human
Target Name
CAPN2
Target Full Name
Calpain-2 catalytic subunit
Target Function
Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Proteolytically cleaves MYOC at 'Arg-226'. Proteolytically cleaves CPEB3 following neuronal stimulation which abolishes CPEB3 translational repressor activity, leading to translation of CPEB3 target mRNAs.
Target Subcellular Location
Cytoplasm. Cell membrane. Note=Translocates to the plasma membrane upon Ca(2+) binding.
Target Protein Families
Peptidase C2 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Calcium activated neutral proteinase 2; Calcium activated neutral proteinase; Calcium-activated neutral protease 2; catalytic subunit; Calcium-activated neutral proteinase 2; CALP80; Calpain 2 (m/II) large subunit; Calpain 2 catalytic subunit; Calpain 2 large catalytic subunit; Calpain 2 large subunit; Calpain 2; large [catalytic] subunit; Calpain large polypeptide L2; Calpain M type; Calpain M-type; Calpain-2 catalytic subunit; Calpain-2 large subunit; Calpain2; CAN2_HUMAN; CANP 2; CANP L2; CANP2; CANPL 2; CANPL2; CANPml; Capa2; CAPN 2; CAPN2; FLJ39928; M calpain; M calpin; M type; M-calpain; mCANP; Millimolar calpain; Millimolar-calpain
Target Background
The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5' UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
