Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAND2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CAND2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00250A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAND2 |
| Target Synonyms | Tp120b; TIP120B; CAND2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, NIH/3T3, Rat heart, 293T, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISD | Uniprot ID | O75155 |
Uniprot Id
O75155
Target Species
Human
Target Name
CAND2
Target Full Name
Cullin-associated NEDD8-dissociated protein 2
Target Function
Probable assembly factor of SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes that promotes the exchange of the substrate-recognition F-box subunit in SCF complexes, thereby playing a key role in the cellular repertoire of SCF complexes.
Target Subcellular Location
Nucleus.
Target Protein Families
CAND family
Target Tissue Specificity
Expressed in epididymis (at protein level).
Target Synonyms
CAND 2; Cand2; CAND2_HUMAN; Cullin associated and neddylation dissociated protein 2; Cullin associated and neddylation dissociated protein 2 putative; Cullin associated NEDD8 dissociated protein 2; Cullin-associated and neddylation-dissociated protein 2; Cullin-associated NEDD8-dissociated protein 2; KIAA0667; p120 CAND2; TATA binding protein interacting protein 120B; TBP interacting protein; TBP-interacting protein 120B; TBP-interacting protein of 120 kDa B; TIP120B; Tp120b
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
