-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD146 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 546-645 of human CD146 (NP_006491.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD146 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 546-645 of human CD146 (NP_006491.2?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08372A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD146 |
| Target Synonyms | CD146; MUC18; HEMCAM; METCAM; MelCAM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HUVEC, Rat lung, SK-MEL-28 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 546-645 of human CD146 (NP_006491.2?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH | Uniprot ID | P43121 |
Uniprot Id
P43121
Target Species
Human
Target Name
MCAM
Target Full Name
Cell surface glycoprotein MUC18
Target Function
Plays a role in cell adhesion, and in cohesion of the endothelial monolayer at intercellular junctions in vascular tissue. Its expression may allow melanoma cells to interact with cellular elements of the vascular system, thereby enhancing hematogeneous tumor spread. Could be an adhesion molecule active in neural crest cells during embryonic development. Acts as surface receptor that triggers tyrosine phosphorylation of FYN and PTK2/FAK1, and a transient increase in the intracellular calcium concentration.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Detected in endothelial cells in vascular tissue throughout the body. May appear at the surface of neural crest cells during their embryonic migration. Appears to be limited to vascular smooth muscle in normal adult tissues. Associated with tumor progress
Target Research Area
Cell Adhesion
Target Synonyms
A32 antigen; CD 146; CD146; CD146 antigen; Cell surface glycoprotein MUC18; Cell surface glycoprotein P1H12; Gicerin; Mcam; Melanoma adhesion molecule; Melanoma associated antigen A32; Melanoma associated antigen MUC18; Melanoma associated glycoprotein MUC18; Melanoma cell adhesion molecule; Melanoma-associated antigen A32; Melanoma-associated antigen MUC18; MelCAM; MUC 18; MUC18; MUC18_HUMAN; S endo 1; S endo 1 endothelial associated antigen; S-endo 1 endothelial-associated antigen
Target Background
Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma.
Notification