-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD1D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-190 of human CD1D (NP_001757.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CD1D was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-190 of human CD1D (NP_001757.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04515A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD1D |
| Target Synonyms | R3; CD1A; R3G1; CD1D | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, THP-1 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-190 of human CD1D (NP_001757.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSG | Uniprot ID | P15813 |
Uniprot Id
P15813
Target Species
Human
Target Name
CD1D
Target Full Name
Antigen-presenting glycoprotein CD1d
Target Function
Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Target Research Area
Immunology
Target Synonyms
Antigen-presenting glycoprotein CD1d; CD1.1; CD1A; CD1d; CD1D antigen; CD1D antigen d polypeptide; CD1d molecule; CD1D_HUMAN; Cd1d1 ; differentiation antigen CD1 alpha 3 ; HMC class I antigen like glycoprotein CD1D ; Ly 38; MGC34622; R3; R3G1; T cell surface glycoprotein CD1d ; Thymocyte antigen CD1D
Target Background
This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. Two transcript variants encoding different isoforms have been found for this gene.
Notification