Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD40L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD40L (NP_000065.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD40L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD40L (NP_000065.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03369A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD40L |
| Target Synonyms | IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD40L (NP_000065.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDKIEDERNLHEDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSN | Uniprot ID | P29965 |
Uniprot Id
P29965
Target Species
Human
Target Name
CD40LG
Target Full Name
CD40 ligand
Target Function
Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Induces tyrosine phosphorylation of isoform 3 of CD28. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching.; Acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.
Target Involvement
Immunodeficiency with hyper-IgM, type 1 (HIGM1)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell surface.; [CD40 ligand, soluble form]: Secreted.
Target Protein Families
Tumor necrosis factor family
Target Tissue Specificity
Specifically expressed on activated CD4+ T-lymphocytes.
Target Research Area
Immunology, Cardiovascular
Target Synonyms
CD 40L; CD154; CD40 antigen ligand; CD40 ligand; CD40 ligand; soluble form; CD40-L; CD40L; CD40L_HUMAN; CD40LG; gp39; hCD40L; HIGM1; IGM; IMD3; T B cell activating molecule; T BAM; T-cell antigen Gp39; TNF-related activation protein; TNFSF5; TrAP; Tumor necrosis factor (ligand) superfamily member 5; Tumor necrosis factor ligand superfamily member 5
Target Background
The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
