Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COL16A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human COL16A1 (NP_001847.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COL16A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human COL16A1 (NP_001847.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07239A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COL16A1 |
| Target Synonyms | 447AA; FP1572; COL16A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, PC-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human COL16A1 (NP_001847.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGL | Uniprot ID | Q07092 |
Uniprot Id
Q07092
Target Species
Human
Target Name
COL16A1
Target Full Name
Collagen alpha-1(XVI) chain
Target Function
Involved in mediating cell attachment and inducing integrin-mediated cellular reactions, such as cell spreading and alterations in cell morphology.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Fibril-associated collagens with interrupted helices (FACIT) family
Target Tissue Specificity
In papillary dermis, is a component of specialized fibrillin-1-containing microfibrils, whereas in territorial cartilage matrix, it is localized to a discrete population of thin, weakly banded collagen fibrils in association with other collagens (at prote
Target Synonyms
447AA; FP1572; COL16A1
Target Background
This gene encodes the alpha chain of type XVI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. High levels of type XVI collagen have been found in fibroblasts and keratinocytes, and in smooth muscle and amnion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
