Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 114-280 of human CPA4 (NP_057436.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CPA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 114-280 of human CPA4 (NP_057436.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07030A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPA4 |
| Target Synonyms | CPA3; CPA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, A-549, HepG2, Mouse brain, Mouse stomach, Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 114-280 of human CPA4 (NP_057436.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGP | Uniprot ID | Q9UI42 |
Uniprot Id
Q9UI42
Target Species
Human
Target Name
CPA4
Target Full Name
Carboxypeptidase A4
Target Function
Metalloprotease that could be involved in the histone hyperacetylation pathway. Releases a C-terminal amino acid, with preference for -Phe, -Leu, -Ile, -Met, -Tyr and -Val.
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase M14 family
Target Tissue Specificity
Fetal expression in the adrenal gland, brain, heart, intestine, kidney, liver and lung. Except for fetal brain that shows no imprinting, expression was found preferentially from the maternal allele.
Target Synonyms
Carboxypeptidase A3; Carboxypeptidase A4; CBPA4_HUMAN; CPA3 ; Cpa4
Target Background
This gene is a member of the carboxypeptidase A/B subfamily, and it is located in a cluster with three other family members on chromosome 7. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This gene could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate gene for prostate cancer aggressiveness.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
