-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cyclin E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13055A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin E1 |
| Target Synonyms | CCNE; pCCNE1; Cyclin E1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG | Uniprot ID | P24864 |
Uniprot Id
P24864
Target Species
Human
Target Name
CCNE1
Target Full Name
G1/S-specific cyclin-E1
Target Function
Essential for the control of the cell cycle at the G1/S (start) transition.
Target Subcellular Location
Nucleus.
Target Protein Families
Cyclin family, Cyclin E subfamily
Target Tissue Specificity
Highly expressed in testis and placenta. Low levels in bronchial epithelial cells.
Target Synonyms
CCNE; Ccne1; CCNE1_HUMAN; cyclin E variant ex5del; cyclin E variant ex7del; Cyclin E1; Cyclin Es; Cyclin Et; CyclinE; G1/S specific cyclin E; G1/S-specific cyclin-E1
Target Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK2, whose activity is required for cell cycle G1/S transition. This protein accumulates at the G1-S phase boundary and is degraded as cells progress through S phase. Overexpression of this gene has been observed in many tumors, which results in chromosome instability, and thus may contribute to tumorigenesis. This protein was found to associate with, and be involved in, the phosphorylation of NPAT protein (nuclear protein mapped to the ATM locus), which participates in cell-cycle regulated histone gene expression and plays a critical role in promoting cell-cycle progression in the absence of pRB.
Notification