-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYTH4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH4 (NP_037517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CYTH4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH4 (NP_037517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05405A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYTH4 |
| Target Synonyms | CYT4; PSCD4; DJ63G5.1; cytohesin-4; CYTH4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH4 (NP_037517.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRK | Uniprot ID | Q9UIA0 |
Uniprot Id
Q9UIA0
Target Species
Human
Target Name
CYTH4
Target Full Name
Cytohesin-4
Target Function
Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF factors through replacement of GDP with GTP.
Target Subcellular Location
Cell membrane; Peripheral membrane protein.
Target Tissue Specificity
Expressed predominantly in peripheral blood leukocytes.
Target Synonyms
AI467541; CYH4_HUMAN; CYT4; Cyth4; Cytohesin 4; Cytohesin-4; DJ63G5.1; FLJ00017; PH; PH, SEC7 and coiled coil domain containing protein 4; Pleckstrin homology, SEC7, AND coiled coil domains protein 4; Pscd4; RGD1564842; SEC7 and coiled-coil domain-containing protein 4
Target Background
This gene encodes a member of the PSCD family of proteins, which have an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family function as GEPs for ADP-ribosylation factors (ARFs), which are guanine nucleotide-binding proteins involved in vesicular trafficking pathways. This protein exhibits GEP activity in vitro with ARF1 and ARF5, but is inactive with ARF6. Alternatively spliced transcript variants have been found for this gene.
Notification