-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNA topoisomerase II alpha (TOP2A) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DNA topoisomerase II alpha (TOP2A) (NP_001058.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNA topoisomerase II alpha (TOP2A) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DNA topoisomerase II alpha (TOP2A) (NP_001058.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12269A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNA topoisomerase II alpha (TOP2A) |
| Target Synonyms | TOP2; TP2A; TOPIIA; TOP2alpha; DNA topoisomerase II alpha (TOP2A) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DNA topoisomerase II alpha (TOP2A) (NP_001058.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA | Uniprot ID | P11388 |
Uniprot Id
P11388
Target Species
Human
Target Name
TOP2A
Target Full Name
DNA topoisomerase 2-alpha
Target Function
Key decatenating enzyme that alters DNA topology by binding to two double-stranded DNA molecules, generating a double-stranded break in one of the strands, passing the intact strand through the broken strand, and religating the broken strand. May play a role in regulating the period length of ARNTL/BMAL1 transcriptional oscillation.
Target Subcellular Location
Cytoplasm. Nucleus, nucleoplasm. Nucleus. Nucleus, nucleolus.
Target Protein Families
Type II topoisomerase family
Target Tissue Specificity
Expressed in the tonsil, spleen, lymph node, thymus, skin, pancreas, testis, colon, kidney, liver, brain and lung. Also found in high-grade lymphomas, squamous cell lung tumors and seminomas.
Target Synonyms
alpha isozyme; ATP hydrolyzing DNA topoisomerase II alfa; DNA gyrase; DNA topoisomerase (ATP hydrolyzing); DNA topoisomerase 2 alpha; DNA topoisomerase 2-alpha; DNA topoisomerase II 170 kD; DNA topoisomerase II alpha isozyme; DNA topoisomerase II; DNA Topoisomerase2; TOP 2A; TOP2; TOP2A; TOP2A_HUMAN; Topoisomerase DNA II alpha 170kDa; TP2A
Target Background
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.
Notification