-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF5A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human EIF5A2 (NP_065123.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EIF5A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human EIF5A2 (NP_065123.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03885A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF5A2 |
| Target Synonyms | EIF-5A2; eIF5AII; EIF5A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse lung, Mouse spleen, Rat lung, SKOV3, SW480, THP-1, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human EIF5A2 (NP_065123.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK | Uniprot ID | Q9GZV4 |
Uniprot Id
Q9GZV4
Target Species
Human
Target Name
EIF5A2
Target Full Name
Eukaryotic translation initiation factor 5A-2
Target Function
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation.
Target Subcellular Location
Cytoplasm. Nucleus. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus, nuclear pore complex.
Target Protein Families
EIF-5A family
Target Tissue Specificity
Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
Target Synonyms
9630038B20; eIF 5A 2; eIF 5A2; eIF-4D; eIF-5A-2; eIF-5A2; EIF5A 2; EIF5A2; eIF5AII; Eukaryotic initiation factor 5A isoform 2; Eukaryotic translation initiation factor 5A-2; Eukaryotic translation initiation factor 5A2; IF5A2_HUMAN
Target Background
Predicted to enable translation elongation factor activity. Predicted to be involved in positive regulation of translational elongation. Located in intracellular membrane-bounded organelle.
Notification