-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ESRRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human ESRRA (NP_004442.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ESRRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human ESRRA (NP_004442.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04499A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ESRRA |
| Target Synonyms | ERR1; ERRa; ESRL1; NR3B1; ERRalpha; ESRRA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HT-29, MCF7, SW620 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human ESRRA (NP_004442.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPK | Uniprot ID | P11474 |
Uniprot Id
P11474
Target Species
Human
Target Name
ESRRA
Target Full Name
Steroid hormone receptor ERR1
Target Function
Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. Binds to the C1 region of the lactoferrin gene promoter. Requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism. Induces the expression of PERM1 in the skeletal muscle.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Nuclear hormone receptor family, NR3 subfamily
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Err 1; ERR a; ERR alpha; ERR-alpha; Err1; ERR1 protein; ERR1_HUMAN; ERRa; ERRalpha; ESRL 1; ESRL1; ESRR A; Esrra; Estrogen receptor like 1; Estrogen receptor related 1; estrogen receptor related receptor alpha; Estrogen receptor-like 1; Estrogen related receptor alpha; Estrogen-related receptor alpha; Estrra; hERR1; NR3B1; Nuclear receptor subfamily 3 group B member 1; Steroid hormone receptor ERR1
Target Background
The protein encoded by this gene is a nuclear receptor that is most closely related to the estrogen receptor. This protein acts as a site-specific transcription factor and interacts with members of the PGC-1 family of transcription cofactors to regulate the expression of most genes involved in cellular energy production as well as in the process of mitochondrial biogenesis. A processed pseudogene of ESRRA is located on chromosome 13q12.1.
Notification