-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FERMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-550 of human FERMT2 (NP_006823.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against FERMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-550 of human FERMT2 (NP_006823.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01127A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FERMT2 |
| Target Synonyms | MIG2; KIND2; mig-2; UNC112; PLEKHC1; UNC112B; FERMT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-1080, HT-29, LO2, MCF7, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-550 of human FERMT2 (NP_006823.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMS | Uniprot ID | Q96AC1 |
Uniprot Id
Q96AC1
Target Species
Human
Target Name
FERMT2
Target Full Name
Fermitin family homolog 2
Target Function
Scaffolding protein that enhances integrin activation mediated by TLN1 and/or TLN2, but activates integrins only weakly by itself. Binds to membranes enriched in phosphoinositides. Enhances integrin-mediated cell adhesion onto the extracellular matrix and cell spreading; this requires both its ability to interact with integrins and with phospholipid membranes. Required for the assembly of focal adhesions. Participates in the connection between extracellular matrix adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits FBLIM1 to focal adhesions. Plays a role in the TGFB1 and integrin signaling pathways. Stabilizes active CTNNB1 and plays a role in the regulation of transcription mediated by CTNNB1 and TCF7L2/TCF4 and in Wnt signaling.
Target Subcellular Location
Cytoplasm. Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, stress fiber. Cell junction, focal adhesion. Membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, lamellipodium membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus. Cytoplasm, myofibril, sarcomere, I band. Cell surface. Note=Colocalizes with actin stress fibers at cell-ECM focal adhesion sites. Colocalizes with ITGB3 at lamellipodia at the leading edge of spreading cells. Binds to membranes that contain phosphatidylinositides.
Target Protein Families
Kindlin family
Target Tissue Specificity
Ubiquitous. Found in numerous tumor tissues.
Target Research Area
Others
Target Synonyms
FLJ34213; FLJ44462; UNC112; FERM2_HUMAN; Fermitin family homolog 2; Fermt2; KIND2; Kindlin-2; MIG-2; MIG2; Mitogen-inducible gene 2 protein; PH domain-containing family C member 1; Pleckstrin homology domain containing family C (with FERM domain) member 1; Pleckstrin homology domain-containing family C member 1; PLEKHC1; UNC112B
Target Background
Enables several functions, including actin binding activity; phosphatidylinositol-3, 4, 5-trisphosphate binding activity; and type I transforming growth factor beta receptor binding activity. Involved in several processes, including cell surface receptor signaling pathway; positive regulation of cell differentiation; and positive regulation of cellular component biogenesis. Acts upstream of or within cell adhesion and protein localization to cell junction. Located in cytosol; focal adhesion; and nucleoplasm. Is extrinsic component of cytoplasmic side of plasma membrane. Part of adherens junction and plasma membrane. Biomarker of acute myeloid leukemia.
Notification