Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLI1 (NP_002008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against FLI1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLI1 (NP_002008.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-11190A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLI1 |
| Target Synonyms | EWSR2; FLI-1; SIC-1; BDPLT21; FLI1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse lung | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLI1 (NP_002008.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPM | Uniprot ID | Q01543 |
Uniprot Id
Q01543
Target Species
Human
Target Name
FLI1
Target Full Name
Friend leukemia integration 1 transcription factor
Target Function
Sequence-specific transcriptional activator. Recognizes the DNA sequence 5'-C[CA]GGAAGT-3'.
Target Involvement
Ewing sarcoma (ES); Bleeding disorder, platelet-type 21 (BDPLT21)
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Research Area
Cancer
Target Synonyms
(Proto-oncogene Fli-1)(Transcription factor ERGB)
Target Background
This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sarcoma cases. An acute lymphoblastic leukemia-associated t(4;11)(q21;q23) translocation involving this gene has also been identified. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
