-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FMNL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 900-1070 of human FMNL1 (NP_005883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FMNL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 900-1070 of human FMNL1 (NP_005883.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03372A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FMNL1 |
| Target Synonyms | FMNL; FHOD4; KW-13; C17orf1; C17orf1B; FMNL1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, LO2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 900-1070 of human FMNL1 (NP_005883.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADTPGKGEPPAPKSPPKARRPQMDLISELKRRQQKEPLIYESDRDGAIEDIIT | Uniprot ID | O95466 |
Uniprot Id
O95466
Target Species
Human
Target Name
FMNL1
Target Full Name
Formin-like protein 1
Target Function
May play a role in the control of cell motility and survival of macrophages. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.
Target Subcellular Location
Cytoplasm. Cell membrane; Lipid-anchor. Cytoplasmic vesicle, phagosome.; [Isoform 3]: Cytoplasm, cell cortex. Cell projection, bleb. Note=Colocalized with F-actin in bleb protrusions.
Target Protein Families
Formin homology family
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
8030453N10Rik; AI553564; C17orf1; C17orf1B; CLL associated antigen KW 13; CLL-associated antigen KW-13; FHOD4; FMNL; FMNL_HUMAN; Fmnl1; Fnrl; Formin like 1; Formin like; Formin related protein; Formin-like protein 1; Frls; KW 13; KW13; Leukocyte formin; MGC133052; MGC1894; MGC21878
Target Background
This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. An alternative splice variant has been described but its full length sequence has not been determined.
Notification