-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GAD67/GAD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GAD67/GAD67/GAD1 (NP_000808.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GAD67/GAD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GAD67/GAD67/GAD1 (NP_000808.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-09836A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GAD67/GAD1 |
| Target Synonyms | GAD; SCP; CPSQ1; DEE89; GAD67/GAD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human GAD67/GAD67/GAD1 (NP_000808.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGL | Uniprot ID | Q99259 |
Uniprot Id
Q99259
Target Species
Human
Target Name
GAD1
Target Full Name
Glutamate decarboxylase 1
Target Function
Catalyzes the production of GABA.
Target Involvement
Cerebral palsy, spastic quadriplegic 1 (CPSQ1)
Target Protein Families
Group II decarboxylase family
Target Tissue Specificity
Isoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain.
Target Synonyms
67 kDa glutamic acid decarboxylase; CPSQ1; DCE1; DCE1_HUMAN; EC 4.1.1.15; FLJ45882; GAD 1; GAD 67; GAD; GAD-67; GAD1; Glutamate decarboxylase 1 (brain; 67kDa); Glutamate decarboxylase 1; Glutamate decarboxylase 1 brain 67kD; Glutamate decarboxylase 1 brain 67kDa; Glutamate decarboxylase 67 kDa isoform; Glutamate decarboxylase; brain; 67-KD; OTTHUMP00000041054; OTTHUMP00000041055; OTTHUMP00000228572; SCP
Target Background
This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.
Notification