Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJB4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB4 (NP_694944.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GJB4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB4 (NP_694944.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00877A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJB4 |
| Target Synonyms | EKV; EKVP2; CX30.3; GJB4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat skin | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB4 (NP_694944.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILL | Uniprot ID | Q9NTQ9 |
Uniprot Id
Q9NTQ9
Target Species
Human
Target Name
GJB4
Target Full Name
Gap junction beta-4 protein
Target Function
Structural component of gap junctions. Gap junctions are dodecameric channels that connect the cytoplasm of adjoining cells. They are formed by the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse from one cell to a neighboring cell via the central pore.
Target Involvement
Erythrokeratodermia variabilis et progressiva 2 (EKVP2)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Beta-type (group I) subfamily
Target Synonyms
GJB4; Gap junction beta-4 protein; Connexin-30.3; Cx30.3
Target Background
This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
