Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GMDS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GMDS (NP_001491.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GMDS was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GMDS (NP_001491.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05292A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GMDS |
| Target Synonyms | GMD; SDR3E1; GMDS | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GMDS (NP_001491.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEV | Uniprot ID | O60547 |
Uniprot Id
O60547
Target Species
Human
Target Name
GMDS
Target Full Name
GDP-mannose 4,6 dehydratase
Target Function
Catalyzes the conversion of GDP-D-mannose to GDP-4-dehydro-6-deoxy-D-mannose.
Target Protein Families
NAD(P)-dependent epimerase/dehydratase family, GDP-mannose 4,6-dehydratase subfamily
Target Synonyms
GDP D mannose dehydratase; GDP mannose 4 6 dehydratase; GDP-D-mannose dehydratase; GDP-mannose 4,6 dehydratase; GMD; Gmds; GMDS_HUMAN; OTTHUMP00000017756; OTTHUMP00000232770; SDR3E1; Short chain dehydrogenase/reductase family 3E member 1
Target Background
GDP-mannose 4, 6-dehydratase (GMD; EC 4.2.1.47) catalyzes the conversion of GDP-mannose to GDP-4-keto-6-deoxymannose, the first step in the synthesis of GDP-fucose from GDP-mannose, using NADP+ as a cofactor. The second and third steps of the pathway are catalyzed by a single enzyme, GDP-keto-6-deoxymannose 3, 5-epimerase, 4-reductase, designated FX in humans (MIM 137020).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
