-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR151 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-419 of human GPR151 (NP_919227.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR151 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-419 of human GPR151 (NP_919227.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04594A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR151 |
| Target Synonyms | GPCR; PGR7; GALR4; GALRL; GPCR-2037; GPR151 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 310-419 of human GPR151 (NP_919227.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKVPSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK | Uniprot ID | Q8TDV0 |
Uniprot Id
Q8TDV0
Target Species
Human
Target Name
GPR151
Target Full Name
G-protein coupled receptor 151
Target Function
Proton-sensing G-protein coupled receptor.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
High expression in the spinal cord.
Target Synonyms
GPR151; GALR4; GALRL; PGR7; G-protein coupled receptor 151; G-protein coupled receptor PGR7; GPCR-2037; Galanin receptor 4; Galanin-receptor-like protein; GalRL
Target Background
This gene encodes an orphan member of the class A rhodopsin-like family of G-protein-coupled receptors (GPCRs). Within the rhodopsin-like family, this gene is a member of the SOG subfamily that includes somatostatin, opioid, galanin, and kisspeptin receptors. The orthologous mouse gene has a restricted pattern of neuronal expression which is induced following nerve injury. All GPCRs have a transmembrane domain that includes seven transmembrane alpha-helices. A general feature of GPCR signaling is the agonist-induced conformational change in the receptor, leading to activation of the heterotrimeric G protein. The activated G protein then binds to and activates numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.
Notification