-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Histone H2A.Z was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFZ (NP_002097.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Histone H2A.Z was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFZ (NP_002097.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15895A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Histone H2A.Z |
| Target Synonyms | H2AZ; H2A.z; H2A/z; H2AFZ; H2A.Z-1; .Z | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, 293T, HepG2, HL-60, MCF7, Mouse testis, Mouse thymus, PC-12 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFZ (NP_002097.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV | Uniprot ID | P0C0S5 |
Uniprot Id
P0C0S5
Target Species
Human
Target Name
H2AZ1
Target Full Name
Histone H2A.Z
Target Function
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Histone H2A family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
H2A histone family member Z; H2A.z; H2A/z; H2afz; H2AZ; H2AZ_HUMAN; Histone H2A.Z; MGC117173
Target Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.
Notification