-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Integrin beta 4 (ITGB4/CD104) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 611-710 of human Integrin beta 4 (ITGB4/CD104) (NP_000204.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Integrin beta 4 (ITGB4/CD104) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 611-710 of human Integrin beta 4 (ITGB4/CD104) (NP_000204.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11609A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Integrin beta 4 (ITGB4/CD104) |
| Target Synonyms | CD104; GP150; JEB5A; JEB5B; Integrin beta 4 (ITGB4/CD104) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse colon, PC-3, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 611-710 of human Integrin beta 4 (ITGB4/CD104) (NP_000204.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGS | Uniprot ID | P16144 |
Uniprot Id
P16144
Target Species
Human
Target Name
ITGB4
Target Full Name
Integrin beta-4
Target Function
Integrin alpha-6/beta-4 is a receptor for laminin. Plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. ITGA6:ITGB4 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGA6:ITGB4 binds to IGF1 and this binding is essential for IGF1 signaling. ITGA6:ITGB4 binds to IGF2 and this binding is essential for IGF2 signaling.
Target Involvement
Epidermolysis bullosa letalis, with pyloric atresia (EB-PA); Generalized atrophic benign epidermolysis bullosa (GABEB)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell membrane; Lipid-anchor. Cell junction, hemidesmosome. Note=Colocalizes with DST at the leading edge of migrating keratinocytes.
Target Protein Families
Integrin beta chain family
Target Tissue Specificity
Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoform beta-4D is also expressed in colon and placenta. Isoform beta-4E is also expressed in epidermis, lung, duodenum, heart, spleen and stomach.
Target Research Area
Signal Transduction
Target Synonyms
CD 104; CD104; CD104 antigen ; gp150; Integrin beta 4 subunit; Integrin beta-4; ITB4_HUMAN; ITG B4; ITGB 4; Itgb4
Target Background
Integrins are heterodimers comprised of alpha and beta subunits, that are noncovalently associated transmembrane glycoprotein receptors. Different combinations of alpha and beta polypeptides form complexes that vary in their ligand-binding specificities. Integrins mediate cell-matrix or cell-cell adhesion, and transduced signals that regulate gene expression and cell growth. This gene encodes the integrin beta 4 subunit, a receptor for the laminins. This subunit tends to associate with alpha 6 subunit and is likely to play a pivotal role in the biology of invasive carcinoma. Mutations in this gene are associated with epidermolysis bullosa with pyloric atresia. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification