-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IRF7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IRF7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12617A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IRF7 |
| Target Synonyms | IMD39; IRF-7; IRF7A; IRF7B; IRF7C; IRF7H; IRF-7H; IRF7 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF7 (NP_001563.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP | Uniprot ID | Q92985 |
Uniprot Id
Q92985
Target Species
Human
Target Name
IRF7
Target Full Name
Interferon regulatory factor 7
Target Function
Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses. Regulates the transcription of type I IFN genes (IFN-alpha and IFN-beta) and IFN-stimulated genes (ISG) by binding to an interferon-stimulated response element (ISRE) in their promoters. Can efficiently activate both the IFN-beta (IFNB) and the IFN-alpha (IFNA) genes and mediate their induction via both the virus-activated, MyD88-independent pathway and the TLR-activated, MyD88-dependent pathway. Induces transcription of ubiquitin hydrolase USP25 mRNA in response to lipopolysaccharide (LPS) or viral infection in a type I IFN-dependent manner. Required during both the early and late phases of the IFN gene induction but is more critical for the late than for the early phase. Exists in an inactive form in the cytoplasm of uninfected cells and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, becomes phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization and nuclear localization where along with other coactivators it can activate transcription of the type I IFN and ISG genes. Can also play a role in regulating adaptive immune responses by inducing PSMB9/LMP2 expression, either directly or through induction of IRF1. Binds to the Q promoter (Qp) of EBV nuclear antigen 1 a (EBNA1) and may play a role in the regulation of EBV latency. Can activate distinct gene expression programs in macrophages and regulate the anti-tumor properties of primary macrophages.
Target Involvement
Immunodeficiency 39 (IMD39)
Target Subcellular Location
Nucleus. Cytoplasm. Note=The phosphorylated and active form accumulates selectively in the nucleus.
Target Protein Families
IRF family
Target Tissue Specificity
Expressed predominantly in spleen, thymus and peripheral blood leukocytes.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
IMD39; Interferon regulatory factor 7; Interferon regulatory factor 7H; IRF 7; IRF 7A; IRF 7H; IRF-7; IRF7; IRF7_HUMAN; IRF7A; IRF7B; IRF7C; IRF7H
Target Background
This gene encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. It has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. The encoded protein plays an important role in the innate immune response against DNA and RNA viruses.
Notification