Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-110 of human LIM2 (NP_085915.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LIM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-110 of human LIM2 (NP_085915.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00768A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIM2 |
| Target Synonyms | MP17; MP19; CTRCT19; LIM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HepG2, Jurkat, Mouse eye, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-110 of human LIM2 (NP_085915.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TDHWMQYRLSGSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLYSRWRTLRLKEGKGATQAYWNATRAFM | Uniprot ID | P55344 |
Uniprot Id
P55344
Target Species
Human
Target Name
LIM2
Target Full Name
Lens fiber membrane intrinsic protein
Target Function
Present in the thicker 16-17 nm junctions of mammalian lens fiber cells, where it may contribute to cell junctional organization. Acts as a receptor for calmodulin. May play an important role in both lens development and cataractogenesis.
Target Involvement
Cataract, multiple types 19 (CTRCT19)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
PMP-22/EMP/MP20 family
Target Tissue Specificity
Eye lens specific.
Target Synonyms
LIM2; Lens fiber membrane intrinsic protein; MP18; MP19; MP20
Target Background
This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization. It acts as a receptor for calmodulin, and may play an important role in both lens development and cataractogenesis. Mutations in this gene have been associated with cataract formation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
