-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARCO was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human MARCO (NP_006761.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MARCO was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human MARCO (NP_006761.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11710A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MARCO |
| Target Synonyms | SR-A6; SCARA2; MARCO | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, HepG2, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human MARCO (NP_006761.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV | Uniprot ID | Q9UEW3 |
Uniprot Id
Q9UEW3
Target Species
Human
Target Name
MARCO
Target Full Name
Macrophage receptor MARCO
Target Function
Pattern recognition receptor (PRR) which binds Gram-positive and Gram-negative bacteria. Also plays a role in binding of unopsonized particles by alveolar macrophages. Binds to the secretoglobin SCGB3A2.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Tissue Specificity
Expressed in alveolar macrophages (at protein level). Detected in macrophages from various tissues including thymus, kidney, Kupffer cells of liver, and spleen.
Target Synonyms
AI323439; Ly112; Macrophage receptor MARCO; Macrophage receptor with collagenous structure; Marco; MARCO_HUMAN; SCARA2; Scavenger receptor class A member 2
Target Background
The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger receptor cysteine-rich (SRCR) domain. In addition to short cytoplasmic and transmembrane domains, there is an extracellular spacer domain and a long, extracellular collagenous domain. The protein may form a trimeric molecule by the association of the collagenous domains of three identical polypeptide chains.
Notification