Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAP1L5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-120 of human NAP1L5 (NP_715638.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAP1L5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-120 of human NAP1L5 (NP_715638.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11557A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAP1L5 |
| Target Synonyms | DRLM; NAP1L5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-120 of human NAP1L5 (NP_715638.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKI | Uniprot ID | Q96NT1 |
Uniprot Id
Q96NT1
Target Species
Human
Target Name
NAP1L5
Target Full Name
Nucleosome assembly protein 1-like 5
Target Subcellular Location
Nucleus.
Target Protein Families
Nucleosome assembly protein (NAP) family
Target Tissue Specificity
Predominantly expressed in brain.
Target Synonyms
1110020M21Rik; down regulated in liver malignancy; DRLM; NAP1L5; NP1L5_HUMAN; Nucleosome assembly protein 1-like 5
Target Background
This gene encodes a protein that shares sequence similarity to nucleosome assembly factors, but may be localized to the cytoplasm rather than the nucleus. Expression of this gene is downregulated in hepatocellular carcinomas. This gene is located within a differentially methylated region (DMR) and is imprinted and paternally expressed. There is a related pseudogene on chromosome 4.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
