-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NBR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human NBR1 (NP_005890.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NBR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human NBR1 (NP_005890.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11233A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NBR1 |
| Target Synonyms | IAI3B; M17S2; MIG19; 1A1-3B; NBR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human NBR1 (NP_005890.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEG | Uniprot ID | Q14596 |
Uniprot Id
Q14596
Target Species
Human
Target Name
NBR1
Target Full Name
Next to BRCA1 gene 1 protein
Target Function
Acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets.
Target Subcellular Location
Cytoplasm. Cytoplasmic vesicle, autophagosome. Lysosome. Cytoplasm, myofibril, sarcomere, M line.
Target Synonyms
1A1 3B; 1A13B; B box protein; Cell migration-inducing gene 19 protein; KIAA0049; M17S2; Membrane component chromosome 17 surface marker 2; Membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); MIG 19; MIG19; Migration inducing protein 19; NBR 1; Nbr1; NBR1, autophagy cargo receptor; NBR1_HUMAN; Neighbor of BRCA1 gene 1; Neighbor of BRCA1 gene 1 protein; Next to BRCA1 gene 1 protein; Ovarian carcinoma antigen CA125; Protein 1A1-3B
Target Background
The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled-coil motif, which is present in many genes with transformation potential. It functions as a specific autophagy receptor for the selective autophagic degradation of peroxisomes by forming intracellular inclusions with ubiquitylated autophagic substrates. This gene is located on a region of chromosome 17q21.1 that is in close proximity to the BRCA1 tumor suppressor gene. Alternative splicing of this gene results in multiple transcript variants.
Notification