-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUMB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 521-640 of human NUMB (NP_003735.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NUMB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 521-640 of human NUMB (NP_003735.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11700A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUMB |
| Target Synonyms | S171; C14orf41; c14_5527; NUMB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Mouse brain, Rat kidney, Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 521-640 of human NUMB (NP_003735.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL | Uniprot ID | P49757 |
Uniprot Id
P49757
Target Species
Human
Target Name
NUMB
Target Full Name
Protein numb homolog
Target Function
Regulates clathrin-mediated receptor endocytosis. Plays a role in the process of neurogenesis. Required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. Not required for the proliferation of neural progenitor cells before the onset of neurogenesis. Also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. May also mediate local repair of brain ventricular wall damage.
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Endosome membrane; Peripheral membrane protein; Cytoplasmic side.
Target Synonyms
c14_5527; C14orf41; FLJ31314; h Numb; h-Numb; Numb; Numb homolog (Drosophila); Numb homolog; Numb protein homolog; NUMB_HUMAN; Protein numb homolog; Protein S171; S171
Target Background
The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.
Notification