-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OPTC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-115 of human OPTC (NP_055174.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OPTC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-115 of human OPTC (NP_055174.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00243A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OPTC |
| Target Synonyms | OPT; OPTC | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-115 of human OPTC (NP_055174.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGL | Uniprot ID | Q9UBM4 |
Uniprot Id
Q9UBM4
Target Species
Human
Target Name
OPTC
Target Full Name
Opticin
Target Function
Inhibits angiogenesis in the vitreous humor of the eye, and therefore represses neovascularization. Binds collagen fibrils. May be involved in collagen fiber organization via regulation of other members of the small leucine-rich repeat proteoglycan superfamily.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class III subfamily
Target Tissue Specificity
Expressed in cartilage and synovial membranes (at protein level). Expressed in the retina, iris, ligament, skin and fetal liver (at protein level). Expressed in the retinal pigment epithelium (at protein level). Expressed in synovial fibroblasts and subch
Target Synonyms
Oculoglycan; OPT; OPT_HUMAN; OPTC; Opticin
Target Background
Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also localizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases age-related macular degeneration (AMD) and posterior column ataxia with retinosa pigmentosa (AXPC1).
Notification