-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p16-ARC/ARC16/ARPC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human p16-ARC/ARC16/p16-ARC/ARC16/ARPC5 (NP_001257368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against p16-ARC/ARC16/ARPC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human p16-ARC/ARC16/p16-ARC/ARC16/ARPC5 (NP_001257368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01167A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p16-ARC/ARC16/ARPC5 |
| Target Synonyms | ARC16; p16-Arc; dJ127C7.3; p16-ARC/ARC16/ARPC5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse small intestine, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human p16-ARC/ARC16/p16-ARC/ARC16/ARPC5 (NP_001257368.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV | Uniprot ID | O15511 |
Uniprot Id
O15511
Target Species
Human
Target Name
ARPC5
Target Full Name
Actin-related protein 2/3 complex subunit 5
Target Function
Component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs).
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection. Nucleus.
Target Protein Families
ARPC5 family
Target Research Area
Signal Transduction
Target Synonyms
Actin related protein 2/3 complex subunit 5 (16 kD); Actin related protein 2/3 complex subunit 5; Actin related protein 2/3 complex; subunit 5 16kDa; Actin-related protein 2/3 complex subunit 5; ARC16; Arp2/3 complex 16 kDa subunit; Arp2/3 protein complex subunit p16; ARPC 5; Arpc5; ARPC5_HUMAN; dJ127C7.3; MGC88523; p16 Arc; p16-ARC; RP1 127C7.3
Target Background
This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene.
Notification