Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PERP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PERP (NP_071404.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PERP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PERP (NP_071404.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05009A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PERP |
| Target Synonyms | THW; KCP1; EKVP7; OLMS2; PIGPC1; KRTCAP1; dJ496H19.1; PERP | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Jurkat, K562, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PERP (NP_071404.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA | Uniprot ID | Q96FX8 |
Uniprot Id
Q96FX8
Target Species
Human
Target Name
PERP
Target Full Name
p53 apoptosis effector related to PMP-22
Target Function
Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway.
Target Subcellular Location
Cell junction, desmosome. Cell membrane; Multi-pass membrane protein.
Target Protein Families
TMEM47 family
Target Tissue Specificity
Expressed in skin, heart, placental, liver, pancreas, keratinocytes and dermal fibroblasts.
Target Synonyms
PERP; KCP1; KRTCAP1; PIGPC1; THW; p53 apoptosis effector related to PMP-22; Keratinocyte-associated protein 1; KCP-1; P53-induced protein PIGPC1; Transmembrane protein THW
Target Background
Involved in activation of cysteine-type endopeptidase activity. Predicted to be located in plasma membrane. Predicted to be active in cell-cell junction. Implicated in erythrokeratodermia variabilis and mutilating palmoplantar keratoderma with periorificial keratotic plaques.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
