-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PI3 Kinase p110 delta was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-300 of human PI3 Kinase p110 delta (NP_005017.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PI3 Kinase p110 delta was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 170-300 of human PI3 Kinase p110 delta (NP_005017.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10440A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PI3 Kinase p110 delta |
| Target Synonyms | APDS; PI3K; IMD14; p110D; IMD14A; IMD14B; ROCHIS; P110DELTA; PI3 Kinase p110 delta | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 170-300 of human PI3 Kinase p110 delta (NP_005017.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR | Uniprot ID | O00329 |
Uniprot Id
O00329
Target Species
Human
Target Name
PIK3CD
Target Full Name
Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
Target Function
Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol (PI) and its phosphorylated derivatives at position 3 of the inositol ring to produce 3-phosphoinositides. Uses ATP and PtdIns(4,5)P2 (phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Mediates immune responses. Plays a role in B-cell development, proliferation, migration, and function. Required for B-cell receptor (BCR) signaling. Mediates B-cell proliferation response to anti-IgM, anti-CD40 and IL4 stimulation. Promotes cytokine production in response to TLR4 and TLR9. Required for antibody class switch mediated by TLR9. Involved in the antigen presentation function of B-cells. Involved in B-cell chemotaxis in response to CXCL13 and sphingosine 1-phosphate (S1P). Required for proliferation, signaling and cytokine production of naive, effector and memory T-cells. Required for T-cell receptor (TCR) signaling. Mediates TCR signaling events at the immune synapse. Activation by TCR leads to antigen-dependent memory T-cell migration and retention to antigenic tissues. Together with PIK3CG participates in T-cell development. Contributes to T-helper cell expansion and differentiation. Required for T-cell migration mediated by homing receptors SELL/CD62L, CCR7 and S1PR1 and antigen dependent recruitment of T-cells. Together with PIK3CG is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in NK cell receptor activation. Plays a role in NK cell maturation and cytokine production. Together with PIK3CG is involved in neutrophil chemotaxis and extravasation. Together with PIK3CG participates in neutrophil respiratory burst. Plays important roles in mast-cell development and mast cell mediated allergic response. Involved in stem cell factor (SCF)-mediated proliferation, adhesion and migration. Required for allergen-IgE-induced degranulation and cytokine release. The lipid kinase activity is required for its biological function. Isoform 2 may be involved in stabilizing total RAS levels, resulting in increased ERK phosphorylation and increased PI3K activity.
Target Involvement
Activated PI3K-delta syndrome (APDS)
Target Subcellular Location
Cytoplasm.
Target Protein Families
PI3/PI4-kinase family
Target Tissue Specificity
In humans, the highest levels of expression are seen in peripheral blood mononuclear cells, spleen, and thymus, and low levels of expression in testes, uterus, colon, and small intestine but not in other tissues examined including prostate, heart, brain,
Target Synonyms
5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; 5-bisphosphate 3-kinase catalytic subunit delta isoform; APDS; GRB1; IMD14; p110d; p110delta; p110dp85a; p85-ALPHA ; Phosphatidylinositol 3 kinase catalytic delta polypeptide; Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit delta isoform; Phosphatidylinositol 4,5 bisphosphate 3 kinase 110 kDa catalytic subunit delta; Phosphatidylinositol 4,5 bisphosphate 3 kinase; catalytic subunit delta; Phosphatidylinositol 45 bisphosphate 3 kinase catalytic subunit delta isoform; Phosphatidylinositol-4; Phosphoinositide 3 kinase B; Phosphoinositide 3 kinase C; Phosphoinositide 3 kinase catalytic delta polypeptide; Phosphoinositide 3 kinase; catalytic; delta polypeptide variant p37delta; PI3 kinase p110 subunit delta; PI3-kinase subunit delta; PI3K; PI3K-delta; PI3Kdelta; Pik3cd; PIK3R1; PK3CD; PK3CD_HUMAN; PtdIns 3 kinase p110; PtdIns 3 kinase subunit p110 delta; PtdIns-3-kinase subunit delta; PtdIns-3-kinase subunit p110-delta
Target Background
Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I PI3K found primarily in leukocytes. Like other class I PI3Ks (p110-alpha p110-beta, and p110-gamma), the encoded protein binds p85 adapter proteins and GTP-bound RAS. However, unlike the other class I PI3Ks, this protein phosphorylates itself, not p85 protein.
Notification