Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PON3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human PON3 (NP_000931.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PON3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human PON3 (NP_000931.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00291A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PON3 |
| Target Synonyms | PON3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PON3 (NP_000931.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTL | Uniprot ID | Q15166 |
Uniprot Id
Q15166
Target Species
Human
Target Name
PON3
Target Full Name
Serum paraoxonase/lactonase 3
Target Function
Has low activity towards the organophosphate paraxon and aromatic carboxylic acid esters. Rapidly hydrolyzes lactones such as statin prodrugs (e.g. lovastatin). Hydrolyzes aromatic lactones and 5- or 6-member ring lactones with aliphatic substituents but not simple lactones or those with polar substituents.
Target Subcellular Location
Secreted, extracellular space.
Target Protein Families
Paraoxonase family
Target Synonyms
2810004E20; AI786302; MGC95026; Paraoxonase 3; Pon3; PON3_HUMAN; Serum paraoxonase/lactonase 3
Target Background
This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydrolyzes lactones and can inhibit the oxidation of low-density lipoprotein (LDL), a function that is believed to slow the initiation and progression of atherosclerosis. Alternatively spliced variants which encode different protein isoforms have been described; however, only one has been fully characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
