-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPIA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-165 of human PPIA (NP_066953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPIA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-165 of human PPIA (NP_066953.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10687A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPIA |
| Target Synonyms | CYPA; CYPH; HEL-S-69p; PPIA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, HepG2, Jurkat, K-562, Mouse brain, Mouse lung, Mouse spleen, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-165 of human PPIA (NP_066953.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE | Uniprot ID | P62937 |
Uniprot Id
P62937
Target Species
Human
Target Name
PPIA
Target Full Name
Peptidyl-prolyl cis-trans isomerase A
Target Function
Catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Exerts a strong chemotactic effect on leukocytes partly through activation of one of its membrane receptors BSG/CD147, initiating a signaling cascade that culminates in MAPK/ERK activation. Activates endothelial cells (ECs) in a proinflammatory manner by stimulating activation of NF-kappa-B and ERK, JNK and p38 MAP-kinases and by inducing expression of adhesion molecules including SELE and VCAM1. Induces apoptosis in ECs by promoting the FOXO1-dependent expression of CCL2 and BCL2L11 which are involved in EC chemotaxis and apoptosis. In response to oxidative stress, initiates proapoptotic and antiapoptotic signaling in ECs via activation of NF-kappa-B and AKT1 and up-regulation of antiapoptotic protein BCL2. Negatively regulates MAP3K5/ASK1 kinase activity, autophosphorylation and oxidative stress-induced apoptosis mediated by MAP3K5/ASK1. Necessary for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and regulates TARDBP binding to RNA UG repeats and TARDBP-dependent expression of HDAC6, ATG7 and VCP which are involved in clearance of protein aggregates. Plays an important role in platelet activation and aggregation. Regulates calcium mobilization and integrin ITGA2B:ITGB3 bidirectional signaling via increased ROS production as well as by facilitating the interaction between integrin and the cell cytoskeleton. Binds heparan sulfate glycosaminoglycans. Inhibits replication of influenza A virus (IAV). Inhibits ITCH/AIP4-mediated ubiquitination of matrix protein 1 (M1) of IAV by impairing the interaction of ITCH/AIP4 with M1, followed by the suppression of the nuclear export of M1, and finally reduction of the replication of IAV.; (Microbial infection) May act as a mediator between human SARS coronavirus nucleoprotein and BSG/CD147 in the process of invasion of host cells by the virus.; (Microbial infection) Stimulates RNA-binding ability of HCV NS5A in a peptidyl-prolyl cis-trans isomerase activity-dependent manner.
Target Subcellular Location
Cytoplasm. Secreted. Nucleus.
Target Protein Families
Cyclophilin-type PPIase family, PPIase A subfamily
Target Research Area
Immunology
Target Synonyms
Cyclophilin A; Cyclophilin; CyclophilinA; Cyclosporin A binding protein ; Cyclosporin A-binding protein; CYPA; CYPH; Epididymis secretory sperm binding protein Li 69p; HEL S 69p; MGC117158; MGC12404; MGC23397; Peptidyl prolyl cis trans isomerase A; Peptidyl-prolyl cis-trans isomerase A; Peptidylprolyl isomerase A (cyclophilin A); Peptidylprolyl isomerase A; PPIA; PPIA protein; PPIA_HUMAN; PPIase A; Rotamase A; RotamaseA; T cell cyclophilin
Target Background
This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.
Notification